SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|10954496|ref|NP_044131.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10954496|ref|NP_044131.1|
Domain Number 1 Region: 1-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.63e-31
Family Extended AAA-ATPase domain 0.0069
Further Details:      
 
Domain Number 2 Region: 229-307
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000112
Family C-terminal fragment of elongation factor SelB 0.07
Further Details:      
 
Domain Number 3 Region: 328-406
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00000858
Family Hjc-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|10954496|ref|NP_044131.1|
Sequence length 439
Comment putative ATPase [Methanocaldococcus jannaschii DSM 2661]
Sequence
MFVDREEELKALNEKLDSNNFEFIVIYGRRRIGKTKLALKSVENREHIYYLAVEGDNLKH
FKRYASKVEPTIEYAKEDWEAYFNFLKDKIIIIDEFPNLIKENPNVLSLFQRIVDIHLKN
TKTKLIILGSSISMMGEKVLSYKSPLYGRKTGVLKIKPLKFKHLKEFFPKAIWEELVEIY
GFADGIPYYLEKVKLPFWDYLDKEIKRVDSFLRYEVDFLMKYEFEEPTTYKKILEAIAFG
NHTLGEIKNYLGFKHSDLTPYLKNLIEVEFIERQTPITESVKSKKGRYYIKDNFIAFYFR
YIFPNLSAIEEGIFDIEEIKADYNQYLGFVFEKVAKEFLIELNKMNKLPFKFLKIGRWWH
RGEEIDLIALNDNDKKALFVEVKWKDLKDRDVKKIYRDLYRKSKLVGLDDYEKYYAIVGK
KIESKENGDCLLFDLEDFS
Download sequence
Identical sequences Q60260
WP_010890051.1.84152 gi|10954496|ref|NP_044131.1|NC_001732 gi|10954496|ref|NP_044131.1| 243232.MJECL04 MjR85

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]