SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15668476|ref|NP_247274.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15668476|ref|NP_247274.1|
Domain Number 1 Region: 14-293
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.76e-33
Family ROO N-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15668476|ref|NP_247274.1|
Sequence length 294
Comment hypothetical protein MJ_0301 [Methanocaldococcus jannaschii DSM 2661]
Sequence
MLMNIGKVDNIKIYTLAEDYAGYNSPFWSQHGLSFLIEVESNGIKKRILFDTATYAEPIL
FNMKLLNINPKSIDMIILSHNHFDHTGGLFGIMKEINKEIPIFAHPNIFKVSFATEPEFM
LAGTLNKTLKEDIEKLGGRWVLSRDPIRLMPGIFTLGEIEDEEKINFEKKPTIGLYKLEN
GRVVLDNVEDEIGLAIVTEKGLIIVSGCSHPGIVSMVKKSIKISGINKVYAVIGGFHLID
ADNERIVSTIKALKKLGVKKICTGHCTGFKAENMFMEEFKEDFERLHAGKIIKF
Download sequence
Identical sequences Q57749
gi|15668476|ref|NP_247274.1| 368090 243232.MJ0301 WP_010869799.1.84152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]