SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15668555|ref|NP_247353.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15668555|ref|NP_247353.1|
Domain Number 1 Region: 146-203
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000455
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.057
Further Details:      
 
Weak hits

Sequence:  gi|15668555|ref|NP_247353.1|
Domain Number - Region: 29-137
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0015
Family Restriction endonuclease EcoO109IR 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15668555|ref|NP_247353.1|
Sequence length 208
Comment hypothetical protein MJ_0379 [Methanocaldococcus jannaschii DSM 2661]
Sequence
MVRYMRYIATFGYHTNHIFDKNGKIIGIDDEKISNMILIYSLDVDADENTVNSIKNTKNY
IESKLKEYNIPYLFVEVNPYEFNTNVKNFRKYIVPKTIINLTGGKRIVGYALFYAAVLEK
ENVEKVFYVSKLGDIIEFPLIPPDIKLTELEMKILNLLDKEGEMSVSNIAHKLERSLSTI
SEYVSQLEKKGLVKKLSKGRRKIVKKVI
Download sequence
Identical sequences Q57824
gi|15668555|ref|NP_247353.1| 243232.MJ0379 376236 MjR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]