SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15668674|ref|NP_247473.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15668674|ref|NP_247473.1|
Domain Number 1 Region: 5-115
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.07e-28
Family Hjc-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15668674|ref|NP_247473.1|
Sequence length 133
Comment hypothetical protein MJ_0497 [Methanocaldococcus jannaschii DSM 2661]
Sequence
MRHKYRKGSSFERELKRLLEKEGFAVIRSAGSKGVDLIAGRKGEVLIFECKTSSKTKFYI
NKEDIEKLISFSEIFGGKPYLAIKFNGEMLFINPFLLSTNGKNYVIDERIKAIAIDFYEV
IGRGKQLKIDDLI
Download sequence
Identical sequences Q57920
243232.MJ0497 WP_010869998.1.84152 gi|15668674|ref|NP_247473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]