SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15668714|ref|NP_247513.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15668714|ref|NP_247513.1|
Domain Number 1 Region: 244-388
Classification Level Classification E-value
Superfamily Flavoproteins 1.68e-34
Family Flavodoxin-related 0.00058
Further Details:      
 
Domain Number 2 Region: 28-280
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.76e-31
Family ROO N-terminal domain-like 0.0000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15668714|ref|NP_247513.1|
Sequence length 391
Comment flavoprotein FprA [Methanocaldococcus jannaschii DSM 2661]
Sequence
MVKYMVLKIKDNIYCMSFIEWKIKEYRGLDIEKGTTYNSYLILDKNNVIIDTTRIKYFDE
LLSYLKDVANLKLDYIISNHISPDHNECIEKLIELTEAKIVTTKIRKYYLDAQFNTKDWE
FVIVKNGDELNIGNRTLKFITDDKCEYMLTYCVEDKILFSNDLFSQHVVYKEKIDSDIGH
KIMLDAKEYFANILLPYRKSILKILNILKDLDLEYICPSHGVIWHIMIDEILTKYRMWCS
DSYKNTAVIVYATIYSSTEKIAKALGEGLSEEGVDVIYHRLDTSPLNIIMRDILDAKYVL
VGSPTINMNVHPKVGMLLTYIEGLKPSNKKIGVAFGSYGWKECATKKIIEAFKRLGFKIV
DDKILTFRFAPKENDIKKIKEFGRKLAKINV
Download sequence
Identical sequences Q57954
gi|15668714|ref|NP_247513.1| 243232.MJ0534 WP_010870038.1.84152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]