SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15668929|ref|NP_247733.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15668929|ref|NP_247733.1|
Domain Number 1 Region: 15-299
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.85e-45
Family ROO N-terminal domain-like 0.00000708
Further Details:      
 
Domain Number 2 Region: 263-410
Classification Level Classification E-value
Superfamily Flavoproteins 2.55e-33
Family Flavodoxin-related 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15668929|ref|NP_247733.1|
Sequence length 416
Comment flavoprotein FpaA [Methanocaldococcus jannaschii DSM 2661]
Sequence
MKKYESRRSKIADGVYWVGVLDWDIRMYHGYTLKGTTYNAYLVFGDEKVALIDNTYPGTS
AQMWGRIKDAFEKEGREFKIDVIVQNHVEKDHSGALPEIHKKFPDAPIYCTEVAVEGLKK
HYPSLKDAQFKVVHTGDTVDLGGKTLTFLEAPLLHWPDSMFTFYNEGGILFSNDAFGQHL
CFPAHKRFDKDIPEYVLMDANQKFYANLITPLSKLVLKKFEEVIQLGLLEKIKMIAPSHG
QIWTDPMKVIKAYQDFATGKAAKDKAVIVYDTMHYSTQKMAHAFAEGLMSEGIDVVMYFL
HYDERSEIVKDILDAKAVLFGIPTIYDEPYPSIGDIIYYLRGLKFNRTGFKRLAVTFGSM
GGEGGAVAKIAEDLAKCGFEVINQYELYYVPTEDELTNCYNMGKELAKRIKEMKIE
Download sequence
Identical sequences Q58158
243232.MJ0748 WP_010870253.1.84152 gi|15668929|ref|NP_247733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]