SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15669417|ref|NP_248227.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15669417|ref|NP_248227.1|
Domain Number 1 Region: 166-294
Classification Level Classification E-value
Superfamily CBS-domain pair 4.8e-36
Family CBS-domain pair 0.0004
Further Details:      
 
Domain Number 2 Region: 3-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000496
Family Heat-inducible transcription repressor HrcA, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15669417|ref|NP_248227.1|
Sequence length 296
Comment hypothetical protein MJ_1232 [Methanocaldococcus jannaschii DSM 2661]
Sequence
MELTVVQREILQELINLYREKNRPIKGTEIALRLNRNPGTIRNQMQALRALDLVDGVPGP
KGGYVPTSKAYRALGLEDEGEIIVPIYKDGKKVEGVKVVKIEFDTVSHEKCCSSKIHIEG
DTKHFNIGDIIRVGPTYHNKIIINGKIIGRDDIHRILLIDVLGVSSIPNIKVGDVGIKEV
WTINPNCTLRETAKLFAEKYISGAPVVDNDKLVGVISLHDIAENIDNIDKKVKEVMRRDV
ITIHKDEKIYDALKIMNKNNVGRLVIVDDNNKIVGIITRTDILKIISGKFPENFHT
Download sequence
Identical sequences Q58629
243232.MJ1232 gi|15669417|ref|NP_248227.1| WP_010870744.1.84152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]