SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15669640|ref|NP_248453.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15669640|ref|NP_248453.1|
Domain Number - Region: 184-274
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0241
Family Restriction endonuclease EcoO109IR 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15669640|ref|NP_248453.1|
Sequence length 370
Comment hypothetical protein MJ_1449 [Methanocaldococcus jannaschii DSM 2661]
Sequence
MPLSKNVIEKISIETIRVLKSRFDTISDEDIKIRNMPFHMAFLRAFYGKIGINDDTEALK
FLTLSQWFHGLSTTLGQSYFENIAHILSNGEKRTFKNYKIKRSVRDKISEIINDLKSGER
LPNVEKENKELREATSKNSEYVNGLEFTADVYFEDKDKVVMIELKTVRPNAGEMRGEKQK
ILYGKAYMMETKPNKKVYYFIGFPYDPTENPENPCGYDKDRFMSSLIEFSKYFDKREVLI
AEELWSFLSGEENTMKKILDIINSIAKPDFKEKFDFINTFPFINQDRLYTKDAIDEQKFK
KYMDILQEWRLYSEIECAKAVKELSLLKLSSRDRRTFERLINNSMFSNNNKYNENRKMKI
LELYNKYMQK
Download sequence
Identical sequences Q58844
WP_010870969.1.84152 243232.MJ1449 gi|15669640|ref|NP_248453.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]