SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15668776|ref|NP_247578.1| from Methanocaldococcus jannaschii DSM 2661

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15668776|ref|NP_247578.1|
Domain Number - Region: 51-121
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0129
Family Restriction endonuclease MspI 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15668776|ref|NP_247578.1|
Sequence length 141
Comment hypothetical protein MJ_0596 [Methanocaldococcus jannaschii DSM 2661]
Sequence
MEDKIEFMAKHKKWFVVKKLKIDENTEDIEIARLLASIDETVLNKIPEYLPFDMNKLYEI
ADGIYQKKKGRITEEEIAEVLKKLKSPATTRKLNEITESKEGKEILKAILNNIILERLGI
QTRVSPKVIEKYIENSQSSNR
Download sequence
Identical sequences Q58013
gi|15668776|ref|NP_247578.1| WP_010870100.1.84152 243232.MJ0596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]