SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479136038|ref|YP_007767838.1| from Bifidobacterium longum subsp. longum F8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479136038|ref|YP_007767838.1|
Domain Number 1 Region: 189-258
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000314
Family Transglutaminase, two C-terminal domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479136038|ref|YP_007767838.1|
Sequence length 391
Comment hypothetical protein BIL_13660 [Bifidobacterium longum subsp. longum F8]
Sequence
MKHLSHHTIAIIVALLSTLSLALAVISLPHQAYAVDGTDGTSGTNSTSQGSDGDSAPIAG
PVPNIIVTNFTYGGDSVAAGSKFNLDFTFQNKGQVSVTNMVVTVDGGESFAIAGGTNTFY
VDALWAGYAMTQSVPMQALASAKSGAQSVTVNFRYEYVDASARSSSQSDVKISVPISQPD
RFEISDPVVPDQVIAGQENTVTMEYVNKGKGDIANVEATMEGEGFDATMKTQYVGNVASG
ATGTIGYAFTPHASGELKTTLKVTYEDSDGQTKTKEFPLTIPVTDMQPMNDSGMADPNME
QNANQGLPVLVYVVIVVIAVVIIVVIVLLVRRRRKQKAKKNDIDEDWDDWSEGKDDKTDT
GVTDGAAADTAPITPVTPASSVAPAGSSHKA
Download sequence
Identical sequences D6D9J3
WP_015512329.1.76388 gi|479136038|ref|YP_007767838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]