SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333986884|ref|YP_004519491.1| from Methanobacterium sp. SWAN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333986884|ref|YP_004519491.1|
Domain Number 1 Region: 168-305
Classification Level Classification E-value
Superfamily Sortase 5.23e-20
Family Sortase 0.016
Further Details:      
 
Weak hits

Sequence:  gi|333986884|ref|YP_004519491.1|
Domain Number - Region: 52-156
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.000173
Family PA0094-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333986884|ref|YP_004519491.1|
Sequence length 307
Comment peptidase C60 sortase A and B [Methanobacterium sp. SWAN-1]
Sequence
MKIKSFYLIVIPCVFIILAVVFAGEKIETNQYNGSDISFDYPQSWQIINGTSTPEIVVFT
DPKSGSNLTVNKQAIPAGYTPPENFTLKSSAAEQSGFKFVSHSVVDLNGTEAHENVYQIT
QNGTSLKRTEIWAEKNGALYSIIFTSPTNSSESSKQLDVVAKSMSIKNSTTENTNIIGTL
SLPTLGKTWNIHTETVNAYNDVYHSPSFYPGENGTVGIYGHHTKYSAPFDEIDQLKVGDQ
VIINDFITQKKYIYQVTSNGDIKWDYETNPVQFLAGNAELTLITCYPKGYSEAAYMTHTQ
LVGVEPL
Download sequence
Identical sequences F6D642
WP_013825192.1.26247 gi|333986884|ref|YP_004519491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]