SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383482142|ref|YP_005391056.1| from Rickettsia montanensis str. OSU 85-930

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383482142|ref|YP_005391056.1|
Domain Number 1 Region: 92-258
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-31
Family DsbA-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383482142|ref|YP_005391056.1|
Sequence length 266
Comment Thiol:disulfide interchange protein dsbA [Rickettsia montanensis str. OSU 85-930]
Sequence
MQHIIGKILVIFVVVIGFLFVFKTMKTYSTNPVSVEVKQSEDTRKCEEERVQEIIKDYLL
KTPEIIIESIEGLQKRKVQENETKVNNYLKDNKLGIEDSTSFPVIGNKDGDVTIIVFYDY
NCSYCKKGDVSINELLQNDPKVKVVLRPLPILGDASEYLARIALAVYKVNPSKFKVVHDE
LIKIRDVSRESIKELLTENGLNATEIEEIADSNEIKDLITQNMKIARSLRMQGVPAYIID
SKLMPGLIDFPQLLNIVKEIRDNKSS
Download sequence
Identical sequences H8KA20 Q9AKQ1
WP_014409141.1.97013 gi|383482142|ref|YP_005391056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]