SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383482422|ref|YP_005391336.1| from Rickettsia montanensis str. OSU 85-930

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383482422|ref|YP_005391336.1|
Domain Number 1 Region: 49-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.34e-50
Family Glutathione peroxidase-like 0.0000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383482422|ref|YP_005391336.1|
Sequence length 205
Comment Sco2 protein [Rickettsia montanensis str. OSU 85-930]
Sequence
MKIQSNVIKIIIVISLLIGVGALYLLLSLRTPEKPLAGQVNIYEDNVKIGGDFELIDQNG
EIFNSDKLKGSLSLIYFGFTSCPDICPTSLNKITEIVEILNKHKIDILPVFITIDPKRDT
PIAIREYLKHFHPKFIGLTGNEQQIKDVTDKFKVFYARVHGDDDDPNYMLDHSSFTYLID
ANGKYLKHFYLDSSPKEIMEFLRNE
Download sequence
Identical sequences H8KBL5
WP_014409390.1.97013 gi|383482422|ref|YP_005391336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]