SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317131095|ref|YP_004090409.1| from Ethanoligenens harbinense YUAN-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317131095|ref|YP_004090409.1|
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.000000000000144
Family N-utilization substance G protein NusG, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317131095|ref|YP_004090409.1|
Sequence length 164
Comment NGN domain-containing protein [Ethanoligenens harbinense YUAN-3]
Sequence
MSMYVLQVLSGAEKDVCAALLDQGIPAYTPEENRQIRSGGLWRARPYLLFRGYVFVVVRD
VRASYYQIRRIPGVLRWLELHAGQATALTPGEEDRIRRMGGQLLESHVLQLADDLFEPVD
GPLKEYADAGVRILYNRHLRRAYVFEPLSVMHNRCLRMSFTLIK
Download sequence
Identical sequences E6U5Z9
gi|317131095|ref|YP_004090409.1| WP_013484059.1.100024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]