SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317132353|ref|YP_004091667.1| from Ethanoligenens harbinense YUAN-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317132353|ref|YP_004091667.1|
Domain Number 1 Region: 7-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.4e-43
Family Glutathione peroxidase-like 0.0000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317132353|ref|YP_004091667.1|
Sequence length 382
Comment alkyl hydroperoxide reductase [Ethanoligenens harbinense YUAN-3]
Sequence
MDTATLPRIGEKAPEFQAQSTHGMICFPADFKGKWVVLLSHPGAFNPVCASEFQEMARLQ
NQFAENNCALVAFSPDSAEAHAAWMRELEKDAPGGAETFAGIPLVADDGGVIARQYGVLP
QGAARPVRGVFFMDPQATIRAVLLYPRGVGRSTGEILRLLLALQAFEADGMPIPANWGPE
AKGAIRTPQPNTGDGATQSMDSHQILAAQENSWSFQAEPISVQPEPQVTPDAVSQPGYAA
AEAVPDTLSNSAFAQESPKPPVGNAKPSRQQLLHPVSQSAWDALAQAQPQMLAPEQALRQ
DAVPSISSFVHTNANAAFKPSAAKSDPSVQTGSQPAPTKTGGSIADQNRRLLGDLLDKED
AENGDSPDGRDYLIMRDFPYKK
Download sequence
Identical sequences E6U6W9
gi|317132353|ref|YP_004091667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]