SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312199288|ref|YP_004019349.1| from Frankia sp. EuI1c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312199288|ref|YP_004019349.1|
Domain Number 1 Region: 9-72
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000109
Family GntR-like transcriptional regulators 0.043
Further Details:      
 
Domain Number 2 Region: 110-244
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000000000183
Family GntR ligand-binding domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312199288|ref|YP_004019349.1|
Sequence length 274
Comment GntR family transcriptional regulator [Frankia sp. EuI1c]
Sequence
MPPSRRRPISAPRVAETIAATLRERILSSTAGDAYRLPTQEQLVEEFGVSYPSVREALRI
LETEGLVTVRRGNVGGGEVHRPDSASSAYHLGLVLQAERVTLGDLAGGLRLFEPLCAAEC
ARRPDRLTAVVPILRANIETSVQLVGTEVAFTQTAREFHELVVALTPNATVRTVVSSLVA
LWSAQEVRWAELLTSQGRYPAEHNAQAVVRTHRRILAEIEAGRAAEAERIARAHLAATQA
LLVDRFDDDVVNAASAKLWQSESPGNPTRPTSRI
Download sequence
Identical sequences E3JC23
gi|312199288|ref|YP_004019349.1| WP_013426597.1.25608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]