SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC01G07170.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC01G07170.1
Domain Number 1 Region: 783-933
Classification Level Classification E-value
Superfamily SET domain 7.98e-45
Family Histone lysine methyltransferases 0.0044
Further Details:      
 
Domain Number 2 Region: 177-290
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.37e-18
Family PWWP domain 0.0034
Further Details:      
 
Domain Number 3 Region: 526-590
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000664
Family PHD domain 0.0071
Further Details:      
 
Domain Number 4 Region: 369-427
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000288
Family PHD domain 0.0074
Further Details:      
 
Weak hits

Sequence:  OPUNC01G07170.1
Domain Number - Region: 637-665
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00487
Family PHD domain 0.019
Further Details:      
 
Domain Number - Region: 443-488
Classification Level Classification E-value
Superfamily SAND domain-like 0.0576
Family SAND domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OPUNC01G07170.1
Sequence length 936
Comment pep:novel chromosome:AVCL00000000:1:5870980:5877672:-1 gene:OPUNC01G07170 transcript:OPUNC01G07170.1 description:""
Sequence
MLASRIPLKRCTAAAVVLPGEGEVEVEMEESPAGGEGSSMMVPAKRRRERVVPSRFRDSV
VALPLPPAKKGRPAKKAAGGGGGDGEVYNVEVRAVEPQGAGFGAVETVVWSGDERPAQTE
EELYRACRNISRSSSSSGFSGSVVTSLSNAGGNAAPEGKSVVVECKPKREGGEKKEDFYW
PEDFVLGDVVWARSGKKCPAWPAVVIDPLLHAPAVVLNSCIPGALCVMFFGYSSGGHGRD
YGWIKQGMIFPFVDYLDRFQGQVLYKLKANRFREAIEEAFLAERGFFELEMDEGCSPEKS
VNDQSVPDCLQEGTGSNNDQECQSDAQVVDKSPGCCDSCGNRVPSKIAKKKKQAGEQLLC
RHCDKLLQSKQYCGICKKIWHHTDGGNWVCCDECQIWVHVECDLTCINMEDLENADYFCP
DCKSKRKTVPPVEQMNTPNSSEILCQCNSCKERLMSLSEWERHTGSRKKNWKMSVKLKSN
GDPLVTLLDDIPCANLKSSTPNINKEELLKLLASSFRPVNARWTTERCAVCRWVEDWDYN
KIIICNRCQIAVHQECYGACDVQDFTNWVCRACELPKQKRECCLCPIKGGALKPTDIDQL
WVHVTCAWFQPKVSFPVDEKMEPAMGILSIPSEYFKKTCVICKQMHGACTQCYKCSTYYH
AMCASRAGYRMELQYSEKNGRNITRMVSYCAFHSTPDPDNVLIVKTPEGVFSTKFLPQNN
EKQTGTRLVRKENLQEKVLPAEISDCPAARCLPYEVLKNKKEPGEAIAHRIMGPRHHSQE
SIECLNACMKIENKRVSCGRSGIHGWGLFAAKKIQEGQMVIEYRGDQVRRSVADLREARY
RREKKDCYLFKISEDVVVDATEQGNIARLINHSCMPNCYARIMSVGNEKSQIILIAKRDV
SAGEELTYDYLFDPDESEDCRVPCLCKAPNCRGYMN
Download sequence
Identical sequences A0A0E0JFM5
OPUNC01G07170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]