SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OPUNC01G34560.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC01G34560.1
Domain Number 1 Region: 89-174
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-19
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OPUNC01G34560.1
Sequence length 515
Comment pep:novel chromosome:AVCL00000000:1:37783131:37786345:-1 gene:OPUNC01G34560 transcript:OPUNC01G34560.1 description:""
Sequence
MAVAMAPRCTLSVLLPVALLLRAALASPDFPLGKNFTVPLYYQQPADLAVTTTTVLNTSR
GAPQRPGVAAAISVVAGTGGLEGLSMCSLVVLLGNVTVWASDHDGGRFLVRGFCRLELTV
DGDLRLTDAAGTVGWSSATGGRRAKVLRLTRSGNLRLLDAKNQSVWQSFDKPTDKLLRGQ
RIGVPSYLTAPVTMIGSAFFSLELKEHTITANLNVGVRRYTYWELTPSPNRSVAFAEMDV
LGLRLLDRQRRPVAQISPAIKAQVSFLSLGEDGNLGMYFYDSHYMKFGPSYEALGFCELP
FACGLRGVCSAAGECDDFSTYGVHEPAPAHRHSACNATTVADQHYMAVMEGVTTALRPAS
PPTTNVTMRQCAESCLRDCSCAAALYVAAEVDHGGACSSYEMTAGAREVIGAGRGHSHRY
LVKAPRTRDCEHEHEDDDSGVNRVLTKILIGFGTLDVIGLCAFTWLCAYYCIYLRDIPVL
DDKDDEADEEEEAARRRDVVMPNPPANSEPVIELN
Download sequence
Identical sequences A0A0E0JQG4
OPUNC01G34560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]