SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OPUNC01G43440.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC01G43440.1
Domain Number 1 Region: 105-239
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-24
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  OPUNC01G43440.1
Domain Number - Region: 163-222,254-299
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00549
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OPUNC01G43440.1
Sequence length 495
Comment pep:novel chromosome:AVCL00000000:1:45217263:45222749:1 gene:OPUNC01G43440 transcript:OPUNC01G43440.1 description:""
Sequence
MRRESLLGVGFALCLLVGGLRAQPFDYPTASPSTTWSNTDAALRHHVAYTDGSVARAALL
RLNPARFGPSFAFGFFCTNHRGGAGAPCANFLLGVAVVYCNSGAGITAVTTGIPQVVWSA
NRATPVGEGATAEFTADGDLVLKSPGGAVLWSAGAAGRGVAGMSINSDGNLVLFDGSNRT
VWQSFDHPTDTLVVGQSLKQGARLTANTSFDNWSEGRIYLTVADDGLAAYVDAKPPQRYY
VLGYSKNAGAYAAYTNGSFTVLDRPGGQQLNMIQLPNVAAGTVQYMRLEYDGHLRLYEWR
SVGMKWEPVGDVLHPYPDDCAYPTVCGAYGVCTDMQCSCPDAANFRAVDFRRPNRGCVPT
AAAPVTCRSRRAHRLVSLRDMAYFNSHDTSMRTLERVSEVACKKACLDDCACMAAQFVYG
FDPNDGFCYLQSEVLSMETMQPEIFHYNSTMHIKTTATRDSRALGSPPAAATPLPTSLYS
GSSSLAPSATRDLRS
Download sequence
Identical sequences A0A0E0JTU7
OPUNC01G43440.1 OPUNC01G43440.2 OPUNC01G43440.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]