SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OPUNC02G16880.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC02G16880.1
Domain Number 1 Region: 87-165,232-253
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000115
Family alpha-D-mannose-specific plant lectins 0.0087
Further Details:      
 
Weak hits

Sequence:  OPUNC02G16880.1
Domain Number - Region: 375-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000628
Family Pan module (APPLE domain) 0.079
Further Details:      
 
Domain Number - Region: 230-292
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0112
Family alpha-D-mannose-specific plant lectins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OPUNC02G16880.1
Sequence length 512
Comment pep:novel chromosome:AVCL00000000:2:21603943:21605481:1 gene:OPUNC02G16880 transcript:OPUNC02G16880.1 description:""
Sequence
MEAARGGRCFVVLCVAMAAVLASLGGGAVEAAAAQELRRGFSAAHDRSYSQFEQVLSDPT
GVFALGFLRINSTMLDLAVLHLPSSFPLWRAIPDSPAQWSAPVSLSFDGDLVLTDPAANK
VLWSAAAAAGDRVVLLNTSNLQIQSDGGGGSLPGIMWQSFDTPSETIVQGQNLTSAAALY
TFDRRFSMRMGTSYFGLYIEPPASSSGGGVAAAMYWKHTALQAKAEIVDGGGPTYARVEP
DGYLAMYQKEGPPADVLSFDTFNHGVRALRRMTLEADGNLRAYYWDSTRSRWVLDYTAIT
DPCGLPTTCGAYAVCVPPSGRCACLANATDGSGCAAASVGGGLCGRTGGEVGGLYWEVRR
QRVEPANKELLPFEHSPSAADCEARCARNCSCWGSVYSNGTGYCYLMDYPAQMMVAADER
KVGYFKVRSLEEAASSGGGRRAAGVKAALLAVGVTVLVAAAAFGAYRVWKRRCRAAVDAR
RQVVADDEGLSPGPYKNLGSFSSVELSSSFRR
Download sequence
Identical sequences A0A0E0K0K1
OPUNC02G16880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]