SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OPUNC03G09990.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC03G09990.1
Domain Number 1 Region: 99-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000393
Family alpha-D-mannose-specific plant lectins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPUNC03G09990.1
Sequence length 315
Comment pep:novel chromosome:AVCL00000000:3:8370063:8371010:-1 gene:OPUNC03G09990 transcript:OPUNC03G09990.1 description:""
Sequence
MGFASCITICLVLAVLLPWHATATSPTGTIQRETKQQILASIPPHWQENPVLFLTSPSGR
YAAYFLRSQTAPGAGGLGADFCYVEVLDTSEPGAEGRSVWESECLAVSTVNTCALVFSWK
GLEVFDGSNSVWHTHDTQSDSQNFLETLELVDEGDMRILDKGGELAWKASDEPRAAQHCG
MPGSPGLASAFPPFAEPIGHGSSDLPFGFGHGGDHVGGNGIGSGAVAQPELPMAPVPQPE
LPMAPVPQEADLGGAAGVEPQGQGVGQTSFGFGAQPLVDNSPYDSGAWKQVGGCSLAAIG
VGFLLNVAIAMGLGH
Download sequence
Identical sequences A0A0E0KB78
OPUNC03G09990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]