SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OPUNC04G17870.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC04G17870.1
Domain Number 1 Region: 43-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.96e-17
Family Arfaptin, Rac-binding fragment 0.053
Further Details:      
 
Domain Number 2 Region: 282-339
Classification Level Classification E-value
Superfamily SH3-domain 6.83e-16
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPUNC04G17870.1
Sequence length 348
Comment pep:novel chromosome:AVCL00000000:4:24996336:25000402:-1 gene:OPUNC04G17870 transcript:OPUNC04G17870.1 description:""
Sequence
MEALWKQASRLKEQVSRQGVFKPFGAAYGNSENAFTDESEVNLHQRLEKLYLSTRAAKHF
QRDIVRGVEGYIITGSKQVDIGNKLSDDSQKYGTGNTCTSGNTLSKAATYYGKACSLMEK
ERGNMLRAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQAVEVSRRQNRVRES
APNGDVISKLEAAEYKLEELKSSMVGLGKEAVAAMAAVEAQQQRLTLQRLIAMMVSERQK
IEAPPTPSAENYMAQPPPSYDEVNGMFASSSVDDAVTSVDFFLGEALDSFKAESESELNL
SAGDIVIVRKISSNGWAEGECKGKAGWFPHGYIERRERVLASKVPHIF
Download sequence
Identical sequences A0A0E0KTC1
OPUNC04G17870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]