SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OPUNC04G26220.2 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC04G26220.2
Domain Number 1 Region: 169-244
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000486
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 273-304
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000235
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 3 Region: 104-134
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000615
Family CCCH zinc finger 0.0023
Further Details:      
 
Domain Number 4 Region: 38-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000392
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OPUNC04G26220.2
Sequence length 308
Comment pep:novel chromosome:AVCL00000000:4:32046689:32053969:1 gene:OPUNC04G26220 transcript:OPUNC04G26220.2 description:"Zinc finger C-x8-C-x5-C-x3-H type family protein "
Sequence
MEGAGAARKRSRPDTANGGAAGGKRSRETESFQTGLSSKSKPCTKFFSTVGCPFGEGCHF
SHFVPGGYQAVAKTLNLGNPAVPAPARAPMDHAAGGNSHSASSGKTRMCTKYNTAEGCKF
GDKCHFAHGERELGKPAYMSHESAMAPMGGRYGSRPEPPPPAAMGPPAGNFGASATAKIS
VDASLAGGIIGKGGVNTKQICRVTGVKLSIRDHESDPNLKNIELEGNFDQIKQASNMVGE
LIATISASTPTKKPAGSAAGAAPAGRGGPGGRNNYKTKLCENFVKGTCTFGDRCHFAHGE
NEQRKGAA
Download sequence
Identical sequences G9C2V0
OPUNC04G26220.1 OPUNC04G26220.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]