SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OPUNC07G14550.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC07G14550.1
Domain Number 1 Region: 43-239
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.81e-43
Family PAPS reductase-like 0.0042
Further Details:      
 
Domain Number 2 Region: 310-423
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.63e-23
Family PDI-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OPUNC07G14550.1
Sequence length 425
Comment pep:novel chromosome:AVCL00000000:7:20888724:20891389:-1 gene:OPUNC07G14550 transcript:OPUNC07G14550.1 description:""
Sequence
MASATASISSHSVALRDLKAARIGAVKQQAPAAAVEAPATAVDYEALAQEMQGASPLEIM
DRALAMFGSDIAIAFSGAEDVALIEYAKLTGRPFRVFSLDTGRLNPETYQLFDKVEKHYG
IRIEYMFPDAGEVQALVRAKGLFSFYEDGHQECCRVRKVRPLRRALRGLRAWITGQRKDQ
SPGTRASIPVVQVDPSFEGLAGGAGSLIKWNPVANVDGKDVWTFLRAMDVPVNALHAQGY
VSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIDKEGSQGGAVAHKAGANGNG
SAGAPDIFESNDVVNLTRAGIENLLRLENRAEPWLVVLYAPWCPFCQAMEASYVELAEKL
GGAGAGVKVGKFRADGEQKAFAQQELQLQSFPTILLFPSRTARPIKYPSEKRDVDSLLAF
VNSLR
Download sequence
Identical sequences A0A0E0LL46
OPUNC07G14550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]