SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484148|ref|YP_005393061.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|383484148|ref|YP_005393061.1|
Domain Number - Region: 1-39
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00167
Family SeqA N-terminal domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484148|ref|YP_005393061.1|
Sequence length 78
Comment hypothetical protein MC1_04580 [Rickettsia parkeri str. Portsmouth]
Sequence
MTRLSIDIPNELHHFLKVHTAHKNDTIMNFVREAIYHKIAQEKALNAESIKILEESAKGL
NINTYSAYKEMYKKLNLI
Download sequence
Identical sequences A0A0F3QR87
WP_014410828.1.24793 WP_014410828.1.3533 WP_014410828.1.42246 WP_014410828.1.49683 gi|383484148|ref|YP_005393061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]