SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|526232417|ref|YP_008326448.1| from Lactobacillus reuteri TD1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|526232417|ref|YP_008326448.1|
Domain Number 1 Region: 3-210
Classification Level Classification E-value
Superfamily CAC2185-like 7.19e-73
Family CAC2185-like 0.000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|526232417|ref|YP_008326448.1|
Sequence length 212
Comment hypothetical protein N134_05800 [Lactobacillus reuteri TD1]
Sequence
MRSYLAKILENSRNDKRKQKLKNQNFTILASECAGGVIYHKLGLKFLSPTINLWFKPSDF
LKFLNNLEYYLNSAPLIEEKNSKLDYPVGILGDKKMKIKLYFLHYTSFQDAMIKWNKRKK
RVNLSNLFVIMTDRDGADIEMLKKFDRLPFENKVILTGKAYPEIKSALLLDNCVEDGHLG
DLFKTNFFTGKSKLDDFDFVEFLNGNGNKLSD
Download sequence
Identical sequences S5N7R4
WP_020843122.1.56784 gi|526232417|ref|YP_008326448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]