SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307723916|ref|YP_003903667.1| from Thermoanaerobacter sp. X513

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307723916|ref|YP_003903667.1|
Domain Number 1 Region: 109-492
Classification Level Classification E-value
Superfamily Subtilisin-like 1.57e-83
Family Subtilases 0.00000898
Further Details:      
 
Domain Number 2 Region: 458-561
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000745
Family Collagen-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307723916|ref|YP_003903667.1|
Sequence length 576
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Thermoanaerobacter sp. X513]
Sequence
MKSRQTLKALLAFVLIVALMSLSGVLVQAQPNLTNFPINSSTKNYLPQIQKVLMQDSNKN
KLFDNLEAKIAGKPDSEKFPVIIIFNKNIDDNELLNISKSIGKFNIKHKYKIIPGIAATL
TKGQINAWSKLDIVKQIEYDEPVYATLDTATKWFGVTKARSDFGVTGDRDGNASSYSKND
IVIAVIDTGIDGSHVDLAGGKVIGWQDFVNGKSTPYDDNGHGTHVASIAAGTGTGNNLYK
GVAPGAALVGIKVLDSNGSGTMSTVTAGIDWAVQNKDVYGIKVINLSLGTSTSSDGTDST
SLAVNGAVDSGIVVVVAAGNSGPARYTIGSPGAAEKAITVAAMADVGELGFNLASFSSRG
PTADGRIKPDIAAPGYNITAAKANSINGYVTYSGTSMATPFVAGTVALMLSANINLAPLD
VKNIIMTTAKSWGPPSKNIDYGVGRLDAYEAIKTAGNFTGTNISVPNHYYAKESLPGSRY
SDIWTFNVTDTSYPIAITFIIPDWANYNPDFDIYLYDPTGTLVKSSTGTQRQETITYIPT
QTGTYYIKVYSFRGSGNYYFDLSVGGGSLTLSSNDI
Download sequence
Identical sequences A0A117KKI8 B0K4J1
WP_009052645.1.26562 WP_009052645.1.81593 WP_009052645.1.95568 gi|167040815|ref|YP_001663800.1| 399726.Teth514_2192 gi|307723916|ref|YP_003903667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]