SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307725447|ref|YP_003905198.1| from Thermoanaerobacter sp. X513

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307725447|ref|YP_003905198.1|
Domain Number 1 Region: 200-238,268-427,578-707
Classification Level Classification E-value
Superfamily Subtilisin-like 6.02e-65
Family Subtilases 0.00035
Further Details:      
 
Domain Number 2 Region: 442-631
Classification Level Classification E-value
Superfamily PA domain 2.75e-27
Family PA domain 0.0024
Further Details:      
 
Domain Number 3 Region: 1324-1404
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000102
Family Invasin/intimin cell-adhesion fragments 0.0078
Further Details:      
 
Domain Number 4 Region: 1497-1574
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000463
Family Invasin/intimin cell-adhesion fragments 0.01
Further Details:      
 
Weak hits

Sequence:  gi|307725447|ref|YP_003905198.1|
Domain Number - Region: 1671-1709
Classification Level Classification E-value
Superfamily SH3-domain 0.000149
Family SH3-domain 0.0032
Further Details:      
 
Domain Number - Region: 1605-1642
Classification Level Classification E-value
Superfamily SH3-domain 0.00149
Family SH3-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307725447|ref|YP_003905198.1|
Sequence length 1776
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Thermoanaerobacter sp. X513]
Sequence
MAKKFLVFLVVFTLVFSAFGTFGYSQQIPTSEYSKLIIDFLKVDYNLLKQIAQDNFKQNF
QPYQSKSKIAERLGKEIQNLGEDAQQEIEKYSPDETVRVIIELQQDSVASYALKANKTLK
TLAETEKANILNKIAQQQNQVKNELTKNFNFKVRHIYKTAINGISGEVKVKDIEKIKLLP
GVKDVRIANEYFLDMTSAVYSTNAPTVWNELGYKGEGMVVAVIDTGIDYRHQDMKVADPN
RVKLTKEKVQQIAAQTGLPYKYFTEKVPVGWNWADNNDEIIDIGATQSMHGQHVAGIIAA
NGNIKGVAPEAQLIVEKVFTNNPNFPSAFSDDIVAGIDHAVAFGADVINMSLGSTAGFVR
PDDPEHVAIKNAVDNGVIVVVSAGNSSYSTSAEFYPYAMDPDIGTVGSPGLWLDAIQVAA
SINPGLTGKSFSVNPAPQGFDKVVYSVGSPSDHDPIDPADVLKGEYEVVYCGLGKPEDFQ
GKDVSGKVALISRGSITFNAKTINAQNAGAVAAIIYNNTTGTISMALGEGTKIPSVSILK
DAGLAIKALLDQGQKVTVKFDGAIATNNLGTPPGDNVTDFSSWGVTPSFDFKPEIMAPGG
GIYSTLNKDSYGLMSGTSMSSPHVAGAMALIAEVLKERVAKGELKFENGRDFVEMAKIMA
MNTAKVIIDTNDNAAPYTGKILRSPKPYSPRQQGAGMIQIDKAIETPVTITDANGKAGIA
LGSIGNSVTFTLILKNHSNSDVTYNLKDEYGVLTDYVLWGFNFAETTTLTGATVKFDKDT
VTVPANGQATVNVTLIIPQNALQNIFAEGFLSFIPQDSSLPKLSVPYTAFYGSWDEPRII
DSPLYEDDTYYGLTGMAGVINNELYFLGNLGSKTPDPSTIAISPNGDGVFDFVQPVLSFL
RNAREFKVSVVDENGNVIREITQEEYIRKNVAATSMARISDSWIWDGTAFNPATGEFEVA
PDGQYYMCFESKIDYPNAKTQLLEMPVKVDTIAPEVMINKDYIDKYGYLKDIYISNGKAT
IEWGGQDEGSGIDSYIILTGKIDPITGNVTNVEAKALPSDANVADVSIPYRYTFIAVVGV
DYAGNVSETTIGQNGCIAFNIDIKDNFGPVINVVEPQVGEIFNTRDIVVSGNIQDETTFM
GKLYINGELVPVDENNNFKTTVHFDSDGRQKIQFLAIDHLYNENDPSTHEHKTEFEVPIY
IDTTTPEITLDTKNLKGYISPNDISLIISGNVHDTGFGYKLYINGNMKSNKEADDYTTFD
DTFAEKISLSREGDTFVLIKAIDEAMNTAEVKITARVYTSEVENYAMLTYEGNQIKVPLE
NVDLVSVAAEPNQIEIPAGKTAKVAITAEFKDRTVDVTNKVRFESADESIAKVEADGTVK
GIKQGETTVTAMYQNKTVEIKVKVVAPVQEGIEVQPSSIEVPAGLTSAIKVYSILSNGEK
IEVTQSAKYTVADKTIAEYNNGVVKGLAKGNTILKVEYSGSSFEVPIKVTEAVLRDIIVQ
PLLIEVQIDGTYQMKVTGIYSDGTEKDITKDANYTSKDTSIATVDKGLVKGVKKGTTVIN
INYGGKTISVNVTVKEKPQLQGVVKALALNVREGASTSTKVIGVLPRGTVVTLLEEVNGW
YKINYNGKTGYIYGVYVTVMPSSSEVKTGRVTASVLNVREEASTSTKVIGTLSKGTVVTL
LEEVNGWYKINYNGKIGYIYGKYVDVISSSSDVTIIKTVKVTAKSGLNVRVSNSTSAAKL
GVVPYGAELKVVGEYNGWYKILYKGGFGYVYAKYTK
Download sequence
Identical sequences B0K540
gi|167040922|ref|YP_001663907.1| 399726.Teth514_2308 gi|307725447|ref|YP_003905198.1| WP_009052115.1.26562 WP_009052115.1.81593 WP_009052115.1.95568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]