SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310817552|ref|YP_003949910.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310817552|ref|YP_003949910.1|
Domain Number 1 Region: 178-467
Classification Level Classification E-value
Superfamily Subtilisin-like 2.36e-64
Family Subtilases 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310817552|ref|YP_003949910.1|
Sequence length 472
Comment peptidase, s8a (subtilisin) subfamily [Stigmatella aurantiaca DW4/3-1]
Sequence
MKSYLLVSKESIETQAREGVRGTARGERQLLRSTALRFGGAERAAEALQQLGLRSATLPG
ARPAVSQSSDKTDKADKKQGRARGHVVTAQATPIPGPVQELTGVENGSYRYMPLIGATMA
HFYSEQAERSARGELEGDFEFVPDVVPLSFPGPVAGQTGPRNRGMASLSEREWPAECGVS
LAHAQGIRGAGVMLGILDTGVDADHPEHASKVIQFRYVSLFPNSPHTPARDIRGFDPSGH
GTHVSGIAAGVHHGVAPEVDLYVASVIESETIRTSLGRVAAGMDWLLHQFSRPENATRPA
VVNMSLGFPVQCPAGISEADYRLNLRALQSMIRRLLDSNVLPVVAAGNSGPNTVGYPAGF
PEALAIGAVDFDRRVASFSASGAVGKRSVPDVMGYGVNIYSSTERRCNNQAFYERMSGTS
MAAPYVAGIAALYRCRAPDLTASEVRDLILGSAVKLPRSSVHRTGKGLAVYR
Download sequence
Identical sequences Q098F9
WP_002612343.1.13107 WP_002612343.1.14028 gi|310817552|ref|YP_003949910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]