SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310817752|ref|YP_003950110.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310817752|ref|YP_003950110.1|
Domain Number 1 Region: 137-583
Classification Level Classification E-value
Superfamily Subtilisin-like 2.46e-79
Family Subtilases 0.0000171
Further Details:      
 
Domain Number 2 Region: 51-119
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000366
Family Subtilase propeptides/inhibitors 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310817752|ref|YP_003950110.1|
Sequence length 586
Comment peptidase, s8a (subtilisin) subfamily [Stigmatella aurantiaca DW4/3-1]
Sequence
MKHWIFLGLAGLVACADSTPPIYEPQDCPDAVESARPVAQAQAVSAPEDETFIVHFRRTV
SASAATRAAGDAVVRMGGQVRARWSQLGAVAAHLTPEARQKLAADPEVLAIYPDHPVHAF
AVARQPAITTGSTAEYTDGLKLVQANSVWDADNDGVLDANAPIGSNIRVCVIDSGWDDRH
PELKAAYVGGKDFVELDDDPRDYDTQSKTWGGGHGTHTAATIVAQLASTGSVNPSEDSAG
VVGVAPGVELLVARVLNTQGTGKLSYILSAMEWCQKEGAKLASLSLGSDESNPLERDAFQ
NALNAGMLAIAAAGNSGTGDPSTEPGVAFPAAYPSVLAVGAVDFDGVHPTFSQVGAALSL
VGPGVDVLSAALSGISSYSELDVAGTRVTSSSLEFAPVGTYEGPLVHCGLGGSRTACGEA
ATCEGFVAYVDRGGTDSQGEGLTFAKKVDAVRRAGARAVIIGNNDPSDGVGRFTLGKAGS
WLPTASISYQDGEALKKLSATQARMNLVSVDYQRLTGTSMATPHVTGVAALVWSARPSLT
AAQVRDILEKSAEPLPRGSAKGSRNDVYGYGLVQAKAALKLLETYP
Download sequence
Identical sequences Q08UU7
WP_002616777.1.13107 WP_002616777.1.14028 gi|310817752|ref|YP_003950110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]