SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310817832|ref|YP_003950190.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310817832|ref|YP_003950190.1|
Domain Number 1 Region: 141-568
Classification Level Classification E-value
Superfamily Subtilisin-like 1.19e-87
Family Subtilases 0.0000165
Further Details:      
 
Weak hits

Sequence:  gi|310817832|ref|YP_003950190.1|
Domain Number - Region: 68-111
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0527
Family Subtilase propeptides/inhibitors 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310817832|ref|YP_003950190.1|
Sequence length 569
Comment subtilisin j [Stigmatella aurantiaca DW4/3-1]
Sequence
MMRWGLLGLLALSACGLDNTGNLLPPEPVCPGAALRTEPLAEAPQALAGGRERFLVRYAA
PDRVDAPQVAFLGGQVRSVYQQVPALAAHLTPGEHAALAGTPGVVGIEPDLPRYALGWPS
LPPQALLHAASRRGSVDEYTPGLNQVQAPAVWDADGDGVLDDGAPTGEGIKVCILDSGID
PAHPELKEAYLEGWDFVEGDAEPWDRTAEGQPGSGHGTHVAGIIAAQLGSDGWPGPGAHR
HGVVGVAPGARLLIARVLNTEGRAWMGDILAGLEWCQRQGAHIASLSLGGPQTSPLEQAA
FQTAEAHGMLIIAAAGNSGGAMEYPAALPSVLAVGAVDAASTRAPFSCQGGNLALMAPGV
DVRSSILTGTGAVSEVALGGTPHASRALFMAPAGHQLRPLVDCGEAHTAHTCLGATCEGF
VAYIQRGTVSLSDQLTHVMRQGATAAIIGNTRDEGGLPDLALDDWGPWVPAAVVSHSSGQ
QLRQRLGAEVDVTLHPSDYTSLTGTSMATPHVAGVAALVWSRRPTLTAAQVRHLLVSAAK
DLGPPGKDPAHGHGLVQAKASLDMLGTWP
Download sequence
Identical sequences Q095Q5
gi|310817832|ref|YP_003950190.1| WP_002612999.1.13107 WP_002612999.1.14028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]