SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310818436|ref|YP_003950794.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310818436|ref|YP_003950794.1|
Domain Number 1 Region: 141-400
Classification Level Classification E-value
Superfamily Subtilisin-like 5.11e-75
Family Subtilases 0.0000117
Further Details:      
 
Domain Number 2 Region: 59-137
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000113
Family Subtilase propeptides/inhibitors 0.0042
Further Details:      
 
Weak hits

Sequence:  gi|310818436|ref|YP_003950794.1|
Domain Number - Region: 779-847
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0501
Family V set domains (antibody variable domain-like) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310818436|ref|YP_003950794.1|
Sequence length 1148
Comment proteinase inhibitor i9 [Stigmatella aurantiaca DW4/3-1]
Sequence
MSTSPRTLAALLGAGMLLSCGERPEPGPAPGAGVSSFSRALDAAPSRGTRLHRAGEAGIA
GRYIVVFSGQESQRLRASPMEVRKASETLSRAYGASVRRVYSSALKGFSAELSEAEALRM
SEDPRVRYIEQERVFTLHGTQSGATWGLDRLDQRELPLDGQYHYEYTGAGVHAYVLDTGI
RDTHVEFTGRMGNGFDAVSGQNPTDCHGHGTHVAGTLGGTTYGVAKDVTLHAVRMIDCSG
EGTLEQLLSGIDWVSANHVKPAVVNMSLGAEGTQAVDDAVTESIAQGITYVVSAGNEGWD
ACAKSPARTPQALTVGATDSFDQRSFFSNFGTCVDLFAPGEEITSAWHTSDTDTVAESGT
SMASPHVAGAAALYLEGHPQATPAEVNEELIARSTRGLVVDPGDGSPDVLLHAACMGSGD
RVKPQVTLTSPEEGAVLTGLVTLSATASDDVLVTRVEFYRDGQLLGTVTQAPYTWSWDSN
EADNGAHTLGVRAFDAGCNSHYASVNVTLQNAGKAAFDEALGTPRCAVVTSQCDSAGLLV
GRGAMGPETHAPNTLLSACPDGDEGWYQFDGSLERLKVVRQDGTLFAAGKQVNIETTFYA
GLFGEVERLDLYSASNIHAPDWRYITTVMPVDYGLNTLSTRFILPGGSEQVIRAVYRTTG
NPGPCVVGPMNDHDDLVFMVGEEQDTVPPTAKLTAPAAGATLKGTVKLTATASDNFGVTH
VEFYAGSTFLAATSTEPFAFSWNTALVPNGPTQLSVRAYDAVGLVGSSAPITVTLDNDLT
PPEVSFTAPAAGAVVKDSVTLSVTATDNVRVARVEFYKDDTKLGSDTTAPYSYTWSTRSS
ANGPYTLSAKAFDAAGNVGTAVRTVTVENDYVPPTASLTSPVASQSVKGTVTFTASASDN
VGVVRVAFFIDGVQAGSDSTAPYSLSYNTRLKANGVRLLQAKAYDAMGNEGESEPVSVTF
DNDLTPPTVVLTSPGEGETLTGTVTFTADASDNVGISWVSFCIDGSQLATDSTPPFTLSY
NTRGKANGVRVITARAYDGVNPVSISQEVRVTFDNDLTLPTTSILSPVSDATVSGTVLIE
AEASDDRGVTLVEFYVGGALKGSATAPPYTYSWDTSKSAVGTVRLMTKAWDAAGNFKTSA
TLPVKVVR
Download sequence
Identical sequences E3FG32
gi|310818436|ref|YP_003950794.1| WP_013374530.1.13107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]