SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310820150|ref|YP_003952508.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310820150|ref|YP_003952508.1|
Domain Number 1 Region: 123-383
Classification Level Classification E-value
Superfamily Subtilisin-like 8.38e-74
Family Subtilases 0.00000345
Further Details:      
 
Domain Number 2 Region: 46-118
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000623
Family Subtilase propeptides/inhibitors 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|310820150|ref|YP_003952508.1|
Domain Number - Region: 788-926
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000152
Family MAM domain 0.03
Further Details:      
 
Domain Number - Region: 415-489
Classification Level Classification E-value
Superfamily E set domains 0.0525
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310820150|ref|YP_003952508.1|
Sequence length 931
Comment peptidase, s8 [Stigmatella aurantiaca DW4/3-1]
Sequence
MSQRRAIPWLVLLTLAACGQPSEDAVSDVPSLSTQGKFLRSSRAVPGEYIVVLAEPQGLE
EMNVSSTAQSLAVEHGGSLRKTFHHALKGFSASLTEAQARALAANPRVKYVEENGFVSLS
ATQTGATWGLDRLDQRALPLDSRYTYNATGVGVHAYIIDTGILQTHQEFAQRIGNGVDEE
TPGGSGADCNGHGTHVAGTVGGTTYGVAKGVTLHAVRVLDCNGEGTYEGVIAGVEWVTAN
HQSPAVANMSLGGGVSQALDDAVTQSINAGVTYAIAAGNDNANACNASPARAPAAVTVGS
VDSRDTRSYFSNFGTCVDIFAPGEGITSSWNTGSTATYVLSGTSMATPHVTGAAALYLER
HPSALPQQVRDALVNNGITGGVINPGTGSSNVLLYTGFILPPGGVEDSIAPSAGVTAPSN
NASLLGTVTLSANASDNIGVTRVEFVVDGISVGSDATAPYAVSWNTTTASNGSHVLVARA
FDAAGNVGTSAPVNFTLNNPGFAAYDTVLKAPKCGTVGPLCDTGALLQGRGSTGPEVNAP
NTLRSSCYDGSSGSYQSDESLEGLRVSTNDGSEFAPGKTVTVTARVWAYGGGFGADSLDL
YFTADANNPSWTFLTTVKPTASGAQTLTATYTLPSGGLQAIRGVFRYFGSAVVCPNGSYD
DIDDLAFAVRSSGGGGDVTPPVTSLTSPSAGAQLGGTVKISATASDNVGVTKVEFYAGNT
LLGTDTSAPYELSWNTLSVANGSYALTSRAYDAVGNVGRSVAVSVSVNNASTGCSGTAQL
LLNPGFEGGNVDWSASSGVIANSSGTARTGSWRALLGGQGEGGTHTLSQQITIPAGACTA
SLKFWLKVSTDEFLTGPAWDTLSVQIQSSAGPVLATLATFSNLDGGSSYVQRTLDLSAYK
GQTVRVYFESNEDFSNQTSFLVDDVSAVVTR
Download sequence
Identical sequences Q08XF4
WP_002615629.1.13107 WP_002615629.1.14028 gi|310820150|ref|YP_003952508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]