SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310820284|ref|YP_003952642.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310820284|ref|YP_003952642.1|
Domain Number 1 Region: 120-375
Classification Level Classification E-value
Superfamily Subtilisin-like 1.83e-76
Family Subtilases 0.00000369
Further Details:      
 
Domain Number 2 Region: 406-510
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.94e-20
Family alpha-D-mannose-specific plant lectins 0.0003
Further Details:      
 
Domain Number 3 Region: 46-116
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000306
Family Subtilase propeptides/inhibitors 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310820284|ref|YP_003952642.1|
Sequence length 513
Comment proteinase inhibitor [Stigmatella aurantiaca DW4/3-1]
Sequence
MRIPKKPALAVTCLVLTACAQEASENETSSQVTSSKFLRSPDAIAGQYIVVLKDTEVSTA
HVPQRAQALATRHGASLSRTYSHALRGFVVRTDEVGARALANEPEVDYVVEDGQAQAIAT
QPNATWGLDRIDQRDRPLNGTYTYDTSGSGVHAYIIDTGILTTHSDFGGRATGDYSAIND
GRGASDCNGHGTHVAGTVGGATWGVAKNVRLHAVRVLDCAGSGAWSGVIAGIDWVAGNHV
KPAVANMSLGGGANQAVDDAVRRSIAAGVVYAVAAGNETTDACTRSPARTPEAITVGATD
NTDTRASWSNSGTCLDLFAPGVNITSAYNNGSTAVLSGTSMASPHVAGAAALYLESNPGA
SPSAVTSALLANTSANKVANPGAGSPNRLLYSRSTSTPPPTCGVLASGQALAPAQVLNAC
AGNSFVAHQGDGNVVVYDRLGASWASNTSGRATSTFVMQTDGNLVLYSSTGAALWYSGTQ
GNPGAYAQMQDDCNFVVYSPNNTPLWASNTRCR
Download sequence
Identical sequences Q090G0
gi|310820284|ref|YP_003952642.1| WP_002614319.1.13107 WP_002614319.1.14028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]