SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310820346|ref|YP_003952704.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310820346|ref|YP_003952704.1|
Domain Number 1 Region: 290-542,569-663
Classification Level Classification E-value
Superfamily Subtilisin-like 3.67e-38
Family Subtilases 0.00013
Further Details:      
 
Domain Number 2 Region: 693-779
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000417
Family Proprotein convertase P-domain 0.001
Further Details:      
 
Domain Number 3 Region: 806-992
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000826
Family Fibronectin type III 0.0043
Further Details:      
 
Weak hits

Sequence:  gi|310820346|ref|YP_003952704.1|
Domain Number - Region: 1643-1710
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00133
Family Invasin/intimin cell-adhesion fragments 0.0091
Further Details:      
 
Domain Number - Region: 2263-2350
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00224
Family Invasin/intimin cell-adhesion fragments 0.013
Further Details:      
 
Domain Number - Region: 1950-2046
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0863
Family Invasin/intimin cell-adhesion fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310820346|ref|YP_003952704.1|
Sequence length 2604
Comment peptidase families s8 and s53 domain-containing protein [Stigmatella aurantiaca DW4/3-1]
Sequence
MTLLACDGPGSDTALSPSEGYRAEASLHKVQLSAEQAARWEKSGTPHQVIGDYGSFKLVQ
VDDEALAALSATESVELRDDSNQLLLNAGVIDTASEHGQSLRGMKARTAGKGLHLVQFAG
PIQPAWYQALEATGVQIITYIPHNAYLVYGDAGALDRLDTHVRTARAVQWNGDYLNDYKL
HPSVLKAVTSTYTVQLVKDDEANGTTLALIRQLQSREGRIREALGYVNVTTALTLPQLYE
IAARPDVVSIQPSFPPKKVDERQNMILAGQVTGNVPSGPGYLAWLASKGFTQAQFTASGF
GVDVSDSGLDNGTQVPNHFGLYTAGDVTAAGRVVYNRLEGTANSGSTIQGCDGHGNLNAH
IVAGYSSLTGAPYTDATGFTHGLGVAPFVKVGSSVVFDPDNFTSPDYEDLQSRAYRDGMR
ISSNSWGAPDDSYDVDAQAYDALVRDAQPTGSAVPAPGNQEMVILFAAGNDGTAAGSVGT
PGTAKNVITVGASENVRAFGASDLCGTSDSEANSLNDVASFSSRGPTADGRKKPDLMAPG
THVAGGVAQDAGQRANPPAVANGKALGCFTAEGVCGGPQNDYYPVGQQWYTASSGTSHST
PAAAGGAALVRQYFINQGLPPPSAAMTKAYLMNSAHYMTGTGANDNLFSNNQGMGLMDLG
FAFDGSPRTLSDQESSHLFTASGQSRTFTGGIVDPTKPFRATLAWTDAPGSTTGSAWKNN
LDLSVTVGGATYKGNVFTKGASVTGGTADDKNNVESVFLPAGTSGAYTLTVTATNINSDG
VPGNGSALDQDFALIVYNTCSTSGPAPTGVTATVAGNNRIDIAWTPDSESTRYTVYRSTT
AGGPYTQVASVTAPPYADTSVSGGLTYYYVVRGVACAESPNSNEASATATGACTQSPTFA
GVSSVTNAGSATCGASVAWSAAAPACGGTLSYMIYRSTDAAFTPSAANLIATGVTGTGFA
DTLNLMNGTVYHYVVRATETSGTGPITETNTVKKSSVVTGAVTPGVNYFDDFDGNRPASA
AAYWIASATQGSAATLAIATGCHYQSATKAYRFGATSAACNTTYPLNTTATLSLGGNGSV
SSSINGFAIPAAALSPEMTFNIWYDLEANYDGVYLAYNTTSASSTWITVSDAVSSTAPYI
SAGGYDGVLVSNLSQRVWTGANKGSNGALKSVTVNLKALAGKKVWFAFRTYSDNTLTAEG
FYVDDVRIAADSAATCTPSAPPPGPAVSYRVSALPASSPAGTPVTFTVTALDSVGQTATG
YTGSASFTSTDPQAVLPPTTAFTAGVASNIPITFKTLGTQSVTATSTVDPSLTHSASTTV
TAGAATRLVFTVQPSTAVAGASVSPSVKVGLVDAFGNAVTTGSNSVTLTLGANPGGATLS
GTTTATMSAGVATFSSLSLNKVGTGYTLVANATGLTSATSAGFQITPAAASKLIFLAQPA
SGSAGVALTPAIQVAVLDRFDNPTASTASLTLALGTNPAGGTLSGTKTVAAVNGVATFGN
LSIDKAGTGYTLRATSGSLTQAVSSAFDITAGTPARVRFTQQPSSTAAGAPITPAVQATI
QDAFGNTAVQSTLPLSVALGNNPGGGTLGGTTTVNAVAGVATFSTLSVSRSGTGYTLVAS
ASGLTPDTSSGFTITPGAPAQLAFTASPSANVLSGAAFPAQVEVRDAQGNVVTGSPLQVT
LSLASAAGATLSGTTVVTTVNGVASFTGLSVDKVGTGYQLQADAPGLPSASSPAFGVEPG
PAVSLAFVTQPSTAAVGVVITPAVQVALKDAHGNTVTSSSEALTLALEAPAPGATLGGTK
TVAALNGVATFTDLTVDKKGTGYLLKASSGALSASSAGFDVTAGAASRLVFRTTPANARA
GEVLGSLEVEFQDLEGNRDTTATAQVTLSLGGASGGTLLGTSTVAAVSGVATFTDLSIHQ
AAEGYTLTAQAAGLPEVTSAAFTITPNTAAALAFHVQPGPGVAGAALTPPVKVAITDAYG
NTVPDAAQEVTLALDTNPSGGTLGGTSTVAAVNGVATFEALSIQRAGTGYTLTATAPSLT
SATSTAFDILASTPTRLAFKLQPQGAAAGSTLGTVSVEFQDAHGNPAASTLPVNLSLQGP
SGATLMGTPTVDALDGVATFSDLSIRQVGTGYRLKAQADGMAEATSNTFDITPGAAAALA
FTVQPGLGQVNAAFNPAVRVSVQDAFGNLATGSTAAITVALGANPGGGTLSGTKTVAAVN
GVATFSNLALDRAAQGYTLKASADSLPTVTSSAFTIVEELVAQLVFRPLPDSGRFTAGAP
FTVQVEVRDSQGHTLPYEGLTVTLSLGENASNGTLAGPSTATTVHGVATFEGLSLRKAAS
QYTLLASAPGALGATSSPFAVIAGPAARLTLELPASVTVGQAVPLSARAVDAYDNLAEAY
GGTVQAASSDPQALLPSPTAFAQGALPSGVSVTFTRPGLTSLTLTDTENPLLTVTAQTTV
TAFTQPTVAITAPADGATVSGKVTLTAEGTVDAGTTLAQLALLVDGQQIATGTNTVLTAT
WDSAASPAGVHVITAVITDSAGNTAVSAPVSVTVQESGNGNGGGNGNGGGCGCGATSSAD
AGFFLGLMALARYSLGRRRRAKAA
Download sequence
Identical sequences E3FTS5
gi|310820346|ref|YP_003952704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]