SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310820530|ref|YP_003952888.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310820530|ref|YP_003952888.1|
Domain Number 1 Region: 170-453
Classification Level Classification E-value
Superfamily Subtilisin-like 7.2e-71
Family Subtilases 0.0000112
Further Details:      
 
Domain Number 2 Region: 843-972
Classification Level Classification E-value
Superfamily PKD domain 0.00000000183
Family PKD domain 0.0055
Further Details:      
 
Domain Number 3 Region: 1385-1536
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000185
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 4 Region: 1603-1746
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000431
Family Fibronectin type III 0.0094
Further Details:      
 
Domain Number 5 Region: 1044-1171
Classification Level Classification E-value
Superfamily PKD domain 0.0000301
Family PKD domain 0.0057
Further Details:      
 
Weak hits

Sequence:  gi|310820530|ref|YP_003952888.1|
Domain Number - Region: 1191-1270
Classification Level Classification E-value
Superfamily Cadherin-like 0.091
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310820530|ref|YP_003952888.1|
Sequence length 1803
Comment serine protease, subtilase family [Stigmatella aurantiaca DW4/3-1]
Sequence
MGWMKPGARQAVPGKRTLVALVLGPLLALQGCTNKEESGAATPRAPRGTTLARPLASGAR
VLRDSNGAEYVAGQLLVRFKKGAGHLVATAAHAQRGAQVLRTYRSQPELQLVTVPEASLK
EVLASYLKDPRIEHAEPNFVYRIHALPDDARFGDLWGMHNTGQSGGTADVDINAPEAWEL
TRGTRTSGVVAVIDTGFDYTHPDLQDNLWTNPGEIPGNHVDDDGNGFIDDVHGINAITHS
GDPLDDNEHGTHCAGTIAGRGNNATGVVGVNWSAQLMGCKFLDSGGSGTLADAVTCLDYV
HLMKTRALHPVNVIATNNSWGGGAFSQELQDAIIQHRDDGILFVAAAGNNNTDNDALASY
PGSYFLSNVISVAAHDRNDTLASFSNYGQRTVHLAAPGVEILSSVPNGKYDSFDGTSMAA
PHVTGVVGLLKAQDPSRDWRQIKNLVLAGAVSSTAAQGKTLTGGRLRASDSGGKGSLTCN
NQVFSSRVRPLLPTASVAVQEPLQIVAYHIRCDAPAGALAVNVTPGNETFLLQDNGQHGD
EVAGDGMYTGYFEPGAAGTYTLSFPEGEPLTVHTALSYTRKEVPAEWRAFTGTSLQQGDD
TVSSLATPFPIPFAQGPGQTLLNISMNGAVSFTSDTIGFHNGPLPAAPHATFVAPFWDDL
YPGPASEDNVYWDVLGVAPHRELVIEWRNVHHRDTRAAAPADTLNFQVVFFEDKPDILFN
YRDVLVNDSTLDKGASATVGVQTADLAAVQYSSDVPSLKNDSSILWRIQTPTTAPVVQPL
AVSPATLTEGDTITVTTSFDDADGATDSPWTVQLDTDFPGWLTPEATQEITQQGPISLSA
PALESGTVLVAVRVTDASGTRSTLEKFPLTVADVAPVLGALSATGVPQENKPTALSVSFT
DPGLDAPWKVEWDLDHDGQTFSADRTSIVTQAGRVTLEHSFPQDGTFTVAARVTDKDGVQ
SNIQVLEITVEDLAPALSPLRGTTSLQEGEAFQLISAFSNPGDNAKPWKVQWDHDYDGTT
FTVDAEESRLTDGDITLSGLATDSGQFRYALRVVDADGSVSDVQALTLDIAEVNPVAKGL
KAQFLTGKGTEPSTVTFELSAVSGAQEASTDPIKAFLWDFDGDGTFDALSTTPQALHSFR
DNPAGGNTFTSLVRVMDEDSFTELTIPVTIDNAPPTLTLPPRTDAVEGSLLALRLTATDP
GADTLTFSVSGAPAGLSVTADGLLLWTPHRQQSSGEGRPHLFTVTVTDDDGASDSQPITL
TVWWKDADGDGMADSWEREHGLDPTRHDADEDLDGDGVSNLTEFLSEHGGPRIPEAAVAG
HPLSGEQVNTPELVLTAQNVKDAGNLATVRYQFQLFADRTLTLPIRDVTVDQVPGADTSA
TLTDGTESETLEDLQDDHVYAWRVRATDGSLHGAWSEVQSITFNPINDAPNAPRTAHPLA
ETQVPTDKLTLITDNALDADDGTLTYTFELARDQAMTQTVLTSGATAAGAHGSTAWIVPS
SLMPFTTYYWRVTATDPHGATSHSDVSSFSTYLGRPSNREPGLPVLAEPSMDSAVSLFTP
TLVAHAARDPDGDALAYVFELDTSPTFNSPNRMASAALEADPDSKVRWQTPALTENTRYF
WRARALDGFSASEWSLHSFKVNTRNDAPSAPVALNPFDAILSTRRLTLRVQNAVDPDGDV
LTYFFEVRLADGTLVATGNGVSEGDRGHTSFTLPSALVRGERYFWTAYAKDAAGALSPPT
AEAHFRISRAHHPSDPSEPGDERYAGCSAGETSLGGMLPLLLMALGMGLRPRRQPRTLRA
PSR
Download sequence
Identical sequences E3FX10
gi|310820530|ref|YP_003952888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]