SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310822144|ref|YP_003954502.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310822144|ref|YP_003954502.1|
Domain Number 1 Region: 204-508
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.51e-78
Family Thermolysin-like 0.000000308
Further Details:      
 
Weak hits

Sequence:  gi|310822144|ref|YP_003954502.1|
Domain Number - Region: 518-610
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00101
Family Collagen-binding domain 0.018
Further Details:      
 
Domain Number - Region: 668-724
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00654
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310822144|ref|YP_003954502.1|
Sequence length 727
Comment Matrix-associated zinc metalloprotease FibA [Stigmatella aurantiaca DW4/3-1]
Sequence
MEGDVTASTAKDTSEDIQTALSALTDVTVLASHDDRTPAFIQGRFGQASRSLAGLRTQDA
HEGVLEVLRNVAPVFRLSPEELYLKRVTTDDRGHQFLRYGQTLNGREVLGAELILFLDRE
GNAYAVNSSARGGQRTLLAAQPAIAAEAAAVSAAAATDAFRKEARGTGRIVYVRGEDGNL
VLTHEIQVTGVRADGLPVDDRLYVNAQNGQIALRDARIHTALSRSVYSANNTSSLPGTLK
RSEGAAATNDAHVDMNYDQLGKTYDCYKTNFNRDSYNSAGALLKSTVHYSENGTGYVNAY
WNGSQMVYGDGDGTTSIELGKDLDVTVHELTHAVTENESNLVYSNEPGALNEGMSDIFAA
YCESWTRSWSTDAQVWMIGEDIWTPGTANDALRYMNNPTKDGFSRDYYPERYTGTSDYGG
VHSNSGIANLAFYLLSAGGTHPRAKTTVTVTGIGVQKAGKIFYEANANCMTSSSNFAAAK
TCTEQKAESFYPADKASVTAAWAAVGVGASTPPPAPVTLTNGTPVTGLSDSANGLKYYKL
TVPAGQTTVKFVTTGSTGDLDLYVKRGSAGDASSYDCKSDGSTSAETCSITNPVAGDYYV
TLLAYSAYSGVTLTGTYSGTSGGNVLTNGVASTAFSGAKSSWTCWTLSVPAGKTKVTFNQ
AGGTSNTGDADLFVQVGAQPTTSAYKCKSENAGNTDSCSVTNPAAGTYYVCSYGYSAYTN
VTLKGTY
Download sequence
Identical sequences E3FE72
gi|310822144|ref|YP_003954502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]