SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310822198|ref|YP_003954556.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310822198|ref|YP_003954556.1|
Domain Number 1 Region: 115-369
Classification Level Classification E-value
Superfamily Subtilisin-like 5.37e-72
Family Subtilases 0.00000128
Further Details:      
 
Domain Number 2 Region: 49-112
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000000000102
Family Subtilase propeptides/inhibitors 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310822198|ref|YP_003954556.1|
Sequence length 389
Comment peptidase s8 and s53 [Stigmatella aurantiaca DW4/3-1]
Sequence
MRAMRQVVFIGSALALSACGGNEMDGQELAGLGQTEAPLQMAPLGKGIPEQYIVVMKKGA
ALQATLASASIAPMHTYQVINGFAASLTKEQLDAVRRDPAVAFVEQDQVVHADVTQRGAT
WGLDRIDQRALPLSTTYAYGQPAFGVSAYIIDTGVTPTHPDFNGRAASVFNSTGDGNPND
CNGHGTHVAGTIGGTTWGVAKGVFLYGVKVLGCSGSGSYAGVIAGVDWVRTNGTKPAVAN
MSLGGGFSQAVNDAVNSLANSGIFVAVAAGNSNADACNYSPASAAAATTAAASESNDARA
YYSNFGPCIDVYAPGSGITSAWLNGGTNTISGTSMASPHIAGVAALYKGNFGDDSSANID
QWIKSNATPNVITGNPAGTPNLLLYKGAL
Download sequence
Identical sequences E3FFH2
WP_013376539.1.13107 gi|310822198|ref|YP_003954556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]