SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310823156|ref|YP_003955514.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310823156|ref|YP_003955514.1|
Domain Number 1 Region: 129-385
Classification Level Classification E-value
Superfamily Subtilisin-like 4.58e-76
Family Subtilases 0.00000221
Further Details:      
 
Domain Number 2 Region: 51-125
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000000283
Family Subtilase propeptides/inhibitors 0.002
Further Details:      
 
Weak hits

Sequence:  gi|310823156|ref|YP_003955514.1|
Domain Number - Region: 522-666
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000103
Family Clostridium neurotoxins, the second last domain 0.084
Further Details:      
 
Domain Number - Region: 413-517
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00914
Family C1 set domains (antibody constant domain-like) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310823156|ref|YP_003955514.1|
Sequence length 669
Comment peptidase [Stigmatella aurantiaca DW4/3-1]
Sequence
MKRITKAACTASFLVLGACGAEMSEQEGDALPPKQELGEMAQLLRSSRAVPNRYIVVLKS
DLKTVSLAADGEIAQQMTLKTGGELLHTYKSAIHGFAARMSEAQARELLADPRVAYIEED
SFVEAVGTQTGATWGIDRIDQAALPLNSTYNYNNDGTGVHAYIVDTGVLTTHTEFTGRIG
NGYDAVTTGGAATDCNGHGSHVAGTVGGTVYGVAKKVTIHPVRVLDCNGSGTTAGVIAGV
DWVKNNHIKPAVANMSLGGGASQTLDDAVANAITAGVVFAVAAGNDNASACNYSPARTPS
AITVGATERTDARASYSNYGTCLDIFAPGSSITSSWYSSTTATNTISGTSMASPHVAGAA
ALYLAANPSATPQQVRDALVNNGTTGKVTSPGTGSPNVLLYTGFIGGGGPNPGDTTPPTT
SITAPAGGASLSGSATISANASDNVGVARVDFFASGVLIGSDTTAPYSISWNTASVANGS
YSLTSTAVDTSGNSGSSAAVSVTVSNTTGNCSTTEQLFLNPGFESGAANWTASSGVISGS
TSGSAPRTGTYKAYLNGYGSSHTDYVYQQVTIPATACSASLSFWVKITTKETENVAYDKL
SVQVRDSANTVKATLATYSNLNKSTDYVLKTFDLAAYKGQTIRVYFNGVEDTSLSTSFFV
DDTSLTITR
Download sequence
Identical sequences E3FZ52
gi|310823156|ref|YP_003955514.1| WP_013377039.1.13107 WP_013377039.1.14028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]