SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310823399|ref|YP_003955757.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310823399|ref|YP_003955757.1|
Domain Number 1 Region: 134-389
Classification Level Classification E-value
Superfamily Subtilisin-like 1.03e-75
Family Subtilases 0.00000303
Further Details:      
 
Domain Number 2 Region: 683-766
Classification Level Classification E-value
Superfamily PKD domain 1.06e-23
Family PKD domain 0.001
Further Details:      
 
Domain Number 3 Region: 58-129
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000085
Family Subtilase propeptides/inhibitors 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|310823399|ref|YP_003955757.1|
Domain Number - Region: 416-509
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0586
Family V set domains (antibody variable domain-like) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310823399|ref|YP_003955757.1|
Sequence length 844
Comment peptidase, s8a [Stigmatella aurantiaca DW4/3-1]
Sequence
MGMGMGMGRGLIVMVAAHMLLTGCQAEIPGEPLARESQETALKESQGKKFRRSADPVEGQ
YIVALKKTNVEMKVHEDALRLASTYNGEVGQVYQHALQGFMIQMSEPDALKLAEDPEVAY
VEENGRVRASGVMDNATWGLDRIDQPDLPLDLKYTYNALGSGVHVYIIDTGIRTTHVEFS
GRASLDYSAITDGNGANDCNGHGTHVAGTVGGATWGVAKEARLHAVRVLDCGGSGTYDGV
IAGVEWVTANHVKPAVANMSLGGGASQAVDDAVTASIAAGVVYVVAAGNDNGNACTKSPA
RTPNAITVGATTNTDARASFSNYGTCVDLFAPGSSITSAWFTSDSATNTLNGTSMASPHV
AGAAALYMGGNPTATPEQVVGMLSNIATPDHVGNAGTDSPNLLLYMASLGNGSGDTVAPT
ASVTAPAHGSSASNTVSITAAASDNVGVIRVSFFVNGVLLGSDASAPYSFSWDTTRAGNG
AYTVMAKAYDAGGNVGSSTTVTVNVSNQGIASYDTALKVPRCMTSGAYCDTGTLVQGRGT
LGPEANAPNTLGSACADGNSGTYQADESLERIRIATVDGTPLAPGKTVRVELTVWSWGSG
SADELDVYYAANANDPSWTFLATLTPTVGGAQVLSATYVLPEGALQAVRGNFRYNGAVGN
CSTGSYDDRDDLVFPVAGGGAAAPVASFTFSCTNLACGFTDTSTNSSGNMVSWNWNFGDG
STSTTSNPNHAYTAAGTYNVSLSVKNSAGKTGTKTQVITVTAPPPPVVMSLTASTWRDFT
GKHVDLSWSGTTTSKVDIFRNNKRLATTPNDGTYADRFFLAGTYIYKVCKAGTNTCTNQV
TVRF
Download sequence
Identical sequences Q08ZC1
WP_002614863.1.13107 WP_002614863.1.14028 gi|310823399|ref|YP_003955757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]