SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310823653|ref|YP_003956011.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310823653|ref|YP_003956011.1|
Domain Number 1 Region: 329-567,594-688
Classification Level Classification E-value
Superfamily Subtilisin-like 1.26e-36
Family Subtilases 0.0000975
Further Details:      
 
Domain Number 2 Region: 719-804
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000179
Family Proprotein convertase P-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 830-900
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000169
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 4 Region: 939-1010
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000883
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310823653|ref|YP_003956011.1|
Sequence length 1918
Comment peptidase s8 and s53 subtilisin kexin sedolisin [Stigmatella aurantiaca DW4/3-1]
Sequence
MTKSVTRPLGTGVRARSAKTLGAVWIMAALACEGPSNTTSTHQQAEGYRADASAHKVQIS
AAQAMQLEKSGAKFQVIGDYGSFKLVQADDQTLAALPGSSDVQLRDNYNDILLNAGVINT
ASAHGQSLRGMRPLASGKGLHIVQFAGPVKPEWYKELEQTGVRVVTYIPNNAYIVYGDAA
ALNKLDSHIRTSRVIQWNSDYLNDFKLDPTAYKSETPTFQVQLVKDAEANEATLGLIRQL
QSRGGKIRESQGYVNVVAYLTRQDLFAIAERPDVISIQPYFTPKKVDERQDMILAGQLTG
NGPTGPGYLAWLQSKGFNTSQIADFGVDVSDSGLDNGTQTPNHFGLYASGNVSNTSRVAY
NRLEGTPNSGSTIQGCDGHGTLNSHIVMGYVAQSGAPHADSLGFAYGLGVAPFVKVGSSV
VFDPGSFTDPVYEDLQSRAYNDGMRVSSNSWGASSNLYTADAQAYDALVRDAQPEGSAHA
TPGNQEMVILFAAGNSGSSANTVGTPGTAKNIITVGASENVHPFGGADACSTGDNEADSA
RDMAGFSSRGPTSDGRKKPDIVAPGTHVSGGVAQTEGQRANPPASPLGDANPCFDATGVC
AGYNSDFHPAGQEWYSASTGTSHSTPAVAGGAALVRQYFINKGITPPSAAMTKAYLLNSA
SYMTGTGANDNLFSNSQGMGLMDLGFAFDGTQRLLTDQTAENLFTATGQTRTIEGTISDS
TKPFRVTLAWTDAPGATSGSAWKNNLDLTVTVGGKTYNGNVFEKGVSIVGGTVDERNNVE
SVFLPAGVTGNYTIKVTAANINSDGVPANGSALDQDFALVAYNSCTDAGEVPTGVTATVS
GDNKIDVSWTTNTSASYAIYRATTAGGPYTRLASATASPYTDTTVSGGTTYYYVVRGVEC
AESANSNEASVTATGVCTLPPTFAGVSSVANAAADTCGTTVSWGAGSAACGGTVSYSIYR
STIQGFTPSSANRIASGVTGTSFSDTANLSQGTTYYYVVRAVESGVAATPVEETNTVEKS
AAPTGVITPGARFFDDLDSNRPANAAAYWIASATLGNANTINLVSGCHYQSATSAYRFGA
ASTTCGGTYPISTDATLSLGGNGSVSPSINGFNIDALASDAKMTFNLWYAFEKDYDGAYL
AYSTTAANGPWTAISDTVSTTQPYIAAGGYDGALRSNSTIRIWTTQNTGANGALKAVTVN
LKALAGKKVWFAFRFYADNLYNYEGVYVDDVRLNADIIASCTTSTPPPGPAVSYKITDLP
ATAQAGSPVTFTVTALDAVGQTATSYTGTASFQSSDAQAVLPANTAFTAGVASGVGITFK
TLGKQTVTATDTSTSSITGNGSTTVTPGAPAGITFTVQPTNVGAGVSITPAVKVGLVDAF
GNAVTTGTNKITVALGNNPTGANLTGTATVAAVAGVATFTGLSLDKVGVGYTLTATVEGI
AGATATSAAFSVVPGPAAKLAFIQQPANGPVGILAPVQVAVQDKFGHTTTSTANVTIALD
ANPAGGTLTGTTTVAAVAGVATFSTLKITKIGAGYTLAATSGSLTKAVSSPFDLGAAPPY
RALFTVQPSNTTAGTPISPAVQVTLYDEFGNLSTGATIPVSIALASNPSGASLNGVTTVV
PVNGVAVFDDLEVDRAGSNYTLVAGASGLYPDTSRGFNVAPGDGGAVTKLVFRAAPSTVV
AGETLSAVQVELQDAQGRVITGGAHTVTLHLGVNPTGVPLLGATSASTVNGVATFDDLSL
RKAGTGYTLRASAATFQSATSAAFTVTPAAAASYKLAFPASVPAGTDVTLTATAYDAYRN
VATPYAGAAKVTSTDAAATFPANVQFADGKASFTVKFATGGLNTITVTDATLETLSASVQ
TNTTTTSTGDGGGDGGGDDDDDDSGCSATSGTDASIYLGLLVLAKYALGRRRRGQLAA
Download sequence
Identical sequences Q08RS7
WP_002618064.1.13107 WP_002618064.1.14028 gi|310823653|ref|YP_003956011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]