SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310824295|ref|YP_003956653.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310824295|ref|YP_003956653.1|
Domain Number 1 Region: 117-372
Classification Level Classification E-value
Superfamily Subtilisin-like 4.32e-73
Family Subtilases 0.00000117
Further Details:      
 
Domain Number 2 Region: 51-113
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000000244
Family Subtilase propeptides/inhibitors 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310824295|ref|YP_003956653.1|
Sequence length 392
Comment alkaline serine exoprotease a [Stigmatella aurantiaca DW4/3-1]
Sequence
MKTVRNTLFLGSALALAACGGELNDSEMLDGAEVGQAEAPLVLAPAGTAVPGSYIVVTKQ
EGGLRRASLASRITPRHSYSVINGFAADLSAEQLAEVRKDPNVLFVEEDAVVQLEATQSN
ATWGIDRIDQESLPLSGTYTYTSTGAGVTAYIIDTGIQVNHSQFGGKAAVAYDAVGDGQN
GNDCQGHGTHVAGTIGSTTYGVAKGVNLRAVRVLNCSGSGTNSGVIAGINWVTSNHVKPA
VANMSLGGSASSAVNTAVTNLSNAGVFVAVAAGNSNANASGFSPASAPAVTTVAASTKTD
ARASYSNYGSLIDIYAPGTDITSTWIGSGTNTISGTSMASPHVAGVGALYKATYGDASSA
TVDAWIKNNASNNKITSNPSGTVNKLLNKRSL
Download sequence
Identical sequences E3FXN1
WP_013377639.1.13107 WP_013377639.1.14028 gi|310824295|ref|YP_003956653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]