SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310824369|ref|YP_003956727.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310824369|ref|YP_003956727.1|
Domain Number 1 Region: 96-269
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4e-40
Family Endonuclease I 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310824369|ref|YP_003956727.1|
Sequence length 278
Comment endonuclease i [Stigmatella aurantiaca DW4/3-1]
Sequence
MNTSSLQRTSFRPTPTVSEAASRSTPAPATRASGRSAAAPFAWGDTFTPSASRPASSTGA
KRAEAPQTPPAAEDPFEGLRDQALLRAIKQSSVGKDVHSYNEARKILFTDLDVHNGKVDC
VYTGRQIDGGRIPNSSDMNVEHTWPQSKGATGDAKSDLHHLFPTDAKANSKRGNFPFGEV
EKVQWSQNGAKFGLDAKGRKVFEPPDEHKGNVARAMFYFSAEYSKAIPNDEEAVLRQWNT
LDSVDAAEVARNRRISELQGNVNQFVEHAELVDRIQDF
Download sequence
Identical sequences Q09AL8
WP_002611542.1.13107 WP_002611542.1.14028 gi|310824369|ref|YP_003956727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]