SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310824851|ref|YP_003957209.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310824851|ref|YP_003957209.1|
Domain Number 1 Region: 96-397
Classification Level Classification E-value
Superfamily Subtilisin-like 8.9e-55
Family Subtilases 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310824851|ref|YP_003957209.1|
Sequence length 408
Comment peptidase, s8a (subtilisin) subfamily [Stigmatella aurantiaca DW4/3-1]
Sequence
MTTVSKLPPASRPTPSSRSETETPRPAAAAAPARAEVRPPVDGFDGAPAARANFVDRPGK
NTFVDRPTGLRPTSAPSAAPERASVASLKGPSNVDAKPPVKPSGPPVVAIFDGGVDTKHT
DLDGALWTNPGEVEGDGIDNDGNGIKDDIHGFNVGFNSGDPMQGAGTDHGTHVAGIIAAE
DNGKGNTGVAAGKAQVLSVGGLYDGADLLTNFERSVDYVVDLKNKGANIRAVNASFGDEY
RDAASQKRWNAAVQKLADADILLVAATANGNGSNMNNVKDFPANVDLPNVITVASMDKKN
DKLASYSSHGDKVVELAAVGEDVLSTVPGNRWEEMSGTSMATPRVAATAALMFAENPNLT
AAQVRDMLVKTVEVDPDLKGKVSTGGKLDIEAAVAAARASAAAAFAAR
Download sequence
Identical sequences Q08XP9
WP_002615527.1.13107 WP_002615527.1.14028 gi|310824851|ref|YP_003957209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]