SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310817768|ref|YP_003950126.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310817768|ref|YP_003950126.1|
Domain Number 1 Region: 22-290
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.28e-78
Family Eukaryotic proteases 0.001
Further Details:      
 
Weak hits

Sequence:  gi|310817768|ref|YP_003950126.1|
Domain Number - Region: 313-388
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0124
Family Collagen-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310817768|ref|YP_003950126.1|
Sequence length 392
Comment peptidase, s1a (chymotrypsin) subfamily [Stigmatella aurantiaca DW4/3-1]
Sequence
MSNPVTVSAASNPLTRRKSWALIASMGAALAAGCGPEAAPETQATLGEASQEIVGGTNAA
ITDFPWQISFQSSSGSHFCGGSIIDANWILTAQHCVYEAANSPSHPSTVRVGAGSATRTG
QVQIKQITDIIPYPGYSDATLGKDVALLRLSSPLTFNTSVKAIPLATAADVSAGRTDPGV
VSTVTGWGTTSSGSSSLPTTLQKVDVPVVSNATASANYGMTITADQIAAGYAAGGKDSCQ
GDSGGPLVVNGASGKILAGVVSWGEGCALPNYPGLYARVSSFQPWINGIITKTPSSLLSQ
TGASAGSKAWKHYTITVPAGVSALTVAASGGSGDADLYVHTSTPTTSAYTCRPYASGNTE
YCSIGSPRAGTWYVSLYGYTAASGVTLKATAY
Download sequence
Identical sequences E3FRW4
WP_013374182.1.13107 gi|310817768|ref|YP_003950126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]