SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310820690|ref|YP_003953048.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|310820690|ref|YP_003953048.1|
Domain Number - Region: 1224-1245
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0379
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310820690|ref|YP_003953048.1|
Sequence length 1374
Comment hypothetical protein STAUR_3431 [Stigmatella aurantiaca DW4/3-1]
Sequence
MRYGAVPDKNTYDCKSTGTTNSETCTLPAMQGGTYYVRMTGPTAFSGVNLTSTYALGKPM
GCTGTSALSNGTPEGSVGAAANDWSCLYALEVPPGASNLRFVTSGGSGNGDVYVKRGAPP
SDTAYDCKSTGATTSESCALATAQAGTWYVRMHGPTAFSGVSLTGSYNTVGPAGCASVIP
LSNGASAGSVSASAANWSCLYTLDVPAGATHLKFVTSGGSGDGDLYVKFGAAPDASTYDC
KSANTSSSETCTLPLAQPGTYHVRMNGYTSFSGVSLTGSYTSTVLSNNTPVDGLGVTLVG
AWSPVYTLEVPPGASNLQFVTSGGTGNSDLYVKFGSPPSDTSYDCKSTGSTPSETCTLPT
ARAGTWYVRAYGASPFSGISLKGSYTPGSPPACTGVLPLSSGTAAGNLGAAAGGWSCTYA
LNVPAGAGNLRFVTSGGSGNGDLYVKQGSVPDSSTFDCKSSGSTTSESCTLPAAAGGTWY
VRVYGASAFSGVNLTGSYIPIDCNVALPNGSPMSNLYAGADTWSCVYALDVPVGASNLRF
VTSGGLGNASMYVKQGSAPDSNTFDCKSAGVTTSETCMIPVAQAGTWYVRLYGATAFSGV
SLTGSYSSNHCTQALSNGVPVGGLYGGADTWSCAYTLEVPADATELKFSTSGGPGSSSLY
VRHGAAPDSSTYDCKSSSFCTIPARAGTWYVRLQTASGFSATSLTGTYIPSIKLSNGIPV
GNINGPYWSAAYTLEVPAGATHLKFVTSGGTGNSDLYVRYGSASNPNVCESKGSTPSETC
NIALPQAGTYYALLSGGTYAGVSLTGSYTTTNPVPPSNDTCATAEPLVFNSSGQAFVQGD
TTLGGNSNGPAEESPTCSPSARASGKDVVYRLVLTEPRSLQVSVTPTDARLAPVVYLRRA
EHCASPVAATELACNATEADGSGPVDLFVPNLPAGEYTLWVDGGVYKNWSGPTSFGRFML
EAELNPPVLPPVNESCQNAQPLVFHHGVARALGDTRTAVNDNPQGCGNSTSLYGGDVAYS
YTLEETQDVFIELRTLETAPSWRPVASMRKGPGCSSYASDDRCLEAHNDGRYFRRFVRQS
PGTYLVWVDGATADEAGPFELKVTVNTPSYNTSCSSAEPLTFDAAGDVFVRGDTSYAGDS
SSTVGASACADNPHNGGDVVYTVTVPPGPPQQVSFVVEPAIDSELFPVLSLRRACALTTP
SDELVCGSQLYYAYRQKVGAAVARLDPGTYYLWVDSDNWDGPFNLYGHMGAPNDTCATAR
PVSLASDAQPAVATTNVGMMNDYGPGSANPYGGTCGNSGEATVDSVYAFTAPASGKYYTN
STAMRFLGETCDPALCTANSVFEAVEGHTYYFVLDHHGYDSAGTRDLRVLPYPW
Download sequence
Identical sequences E3G018
gi|310820690|ref|YP_003953048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]