SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310821131|ref|YP_003953489.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310821131|ref|YP_003953489.1|
Domain Number 1 Region: 150-529
Classification Level Classification E-value
Superfamily Subtilisin-like 2.88e-72
Family Subtilases 0.00000581
Further Details:      
 
Domain Number 2 Region: 630-729
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-21
Family Proprotein convertase P-domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|310821131|ref|YP_003953489.1|
Domain Number - Region: 509-597
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00484
Family Collagen-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310821131|ref|YP_003953489.1|
Sequence length 729
Comment peptidase s8 and s53 subtilisin kexin sedolisin [Stigmatella aurantiaca DW4/3-1]
Sequence
MERGQRDGPGTVRTGRQRSAGPLYAFHLIQGASRMNRFIGSLWLQALTATSALGVAAVGR
PAEAAGRVELNALQAEGQYNRFIVKYREDSAEFAQPESVQRHLDATTQRAVALKGAAPLV
LGHVRRLAVGADVVSVDRKLDRTGAETLMREIAADPNVEYVEVDRLNKPFATPNDTRYGE
QWHYFDAVGGLNLPPAWDLATGSGVVVAVLDTGITNHSDLNANVVPGYDFIVDTAVAGDG
NGRDADPSDPGDFEGGYSSSWHGTHVAGTIAAVTNNSKGVAGVAYGAKISPVRVLGRGGG
YDSDISDAIIWASGGSVSGVPANANPAKVINLSLGGSGSCGSTSQSAINAAVGRGTVLVI
AAGNSNANVSGFSPANCNNVIAVAANGKTGARASYSNYGSLIDVTAPGGDGSYGILSTLN
TGSTTPGSETYDGTYQGTSMAAPHVAGVVALIQSVASKTPAEIETILKSTARALPGSCTG
GCGAGIVDAYAAVQAAKGGGNPNPPGDNVLTNNVPVTGLSGSANTELRYTLAVPAGSSNL
TIATSEGTGDADIYVKFGSAPTTTSYDCRPYKSGNVESCAFATPQTGTYHVMVRGYSTFS
GVKLLGSYTAGSGGGGQSFFENTTDFSILDKATIESPITVSGRTGNAPSTLKVSVSIYHT
YQGDLKVDLIAPDGSVYVLHNYTGSGTDNIITTYTVNASSEVANGTWKLRVNDKAAGDTG
YLDKWSLQF
Download sequence
Identical sequences E3FJI3
WP_013375938.1.13107 WP_013375938.1.14028 gi|310821131|ref|YP_003953489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]