SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310822932|ref|YP_003955290.1| from Stigmatella aurantiaca DW4/3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310822932|ref|YP_003955290.1|
Domain Number 1 Region: 497-601
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000183
Family Collagen-binding domain 0.0081
Further Details:      
 
Weak hits

Sequence:  gi|310822932|ref|YP_003955290.1|
Domain Number - Region: 35-135
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00144
Family Collagen-binding domain 0.0082
Further Details:      
 
Domain Number - Region: 157-200
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00641
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310822932|ref|YP_003955290.1|
Sequence length 621
Comment hypothetical protein STAUR_5700 [Stigmatella aurantiaca DW4/3-1]
Sequence
MRRLVWIAVCAALAGCPKGKEEVPDAGPPIDPGPDALTEKEPNERPDQALALIRDAVVTG
ALSADPSKQDEDWYRLAPSTARTADITLSGIPGVDVTLEVYDRDRNRLGNVNSEGEGKPE
RFPNLFVEGERFVRVASARKGSGGAYTLTLSYRRPNDGEEREPNDRAVDASPLTLGQAVA
AYIGHSGDEDWYRVELPAPEAASPPSAEPPPPPPTEAPPPTPPTEGLAAPTEEATTPTEG
IVPPEALGGDAGVPGAVAQGGDAGAPPPPEPPSVALKIDLSALDGVRPEISVLSAAEAPL
FSLRGKEGEALSLRNIGVRATDRMVYVVVKSGWMGTGKEARRAYNATNAYTLSVSLEEAG
ANAELEPNDELYKATPLTSAGFKEGFLAPKSDVDHYVLRTSEPVLAKVELSGVDRLDLVL
SAVEPPTGDGAQETVTLRANDGAVKEPERLNNVSCRETCYFRVESATRKIDGKWVKDFEN
ADLPYRISVTTVPDNGSEESEPNNTAARATELTFGKPLRGTVYPVKDVDYYRLDLSDRPV
RTSLRATLLGILKVDVGLYLHRMGEDGKLSLVQTADRAKGDQPETIRYSAEPGVYLLEVR
DTKNRESNFQDAYQLSVEEGE
Download sequence
Identical sequences E3FVS3
WP_013376923.1.13107 gi|310822932|ref|YP_003955290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]