SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89055159|ref|YP_510610.1| from Jannaschia sp. CCS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89055159|ref|YP_510610.1|
Domain Number 1 Region: 150-233
Classification Level Classification E-value
Superfamily LCCL domain 6.67e-20
Family LCCL domain 0.0014
Further Details:      
 
Domain Number 2 Region: 36-122
Classification Level Classification E-value
Superfamily LCCL domain 8.11e-20
Family LCCL domain 0.001
Further Details:      
 
Weak hits

Sequence:  gi|89055159|ref|YP_510610.1|
Domain Number - Region: 8-50
Classification Level Classification E-value
Superfamily ApbE-like 0.023
Family DVU1097-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89055159|ref|YP_510610.1|
Sequence length 234
Comment hypothetical protein Jann_2668 [Jannaschia sp. CCS1]
Sequence
MTPLPKQSLGLGVAAAATLLCATPSLADWSANLIARGLDTPGATGQIECPPNGAVATVWG
TGTYTSDSSICTAALHYGWITLDVGGLVGFRQVAGLDRYEGTSQNGVTTLDYGSWNSSFQ
ITSAEPLGTSAGQAIQISWSDDVDAIGYGDRVGESVTVTCPADRFGAGQVWGTDVYSSDS
PICNAAVHRGLMIAAEGGTVTILILGEQPAFTGSTRNGVTTADYTAWPRSYIFQ
Download sequence
Identical sequences Q28NX7
gi|89055159|ref|YP_510610.1| 290400.Jann_2668 WP_011455789.1.50977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]