SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89055311|ref|YP_510762.1| from Jannaschia sp. CCS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89055311|ref|YP_510762.1|
Domain Number 1 Region: 195-270
Classification Level Classification E-value
Superfamily LCCL domain 4.84e-19
Family LCCL domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89055311|ref|YP_510762.1|
Sequence length 425
Comment hypothetical protein Jann_2820 [Jannaschia sp. CCS1]
Sequence
MAHRAATASGLHSRIYCQHLLSPRPGAVIFPNFVRGRPILTSKGMLVSHQLLKAIALSLL
ALPVATSALAQDVDPDRVTGFVSALEAHGCRLSQTDVQDFVLSNGFGDARETQAIVGSLI
AAGDARTEGADLVLETAGCPGGTGAATPAPAPVPVPAPAPVATPAPAPVPVPAPAPQPVQ
ALAQCPANALSLSANTQCSCPANPGGTIWGSNVYTADSNICLAALHAGAMPITGGNISIT
LGGRLETFTGTAQNGVTSNAWGAYDTSFTLAAVQAPAPQPIPQPLPQATGSCPSFAVPGD
FYAATGDQLYSPTPFTVQAGGPLDISGCQVGGIGFVTEVPQISVNLSGMEAYGRLEIEVE
AQCDTTLLINTPTGQWVFDDDSRGNFQPLVNLPSSAAMNGRIDIWVGSYNGSACPATVEL
ETWNS
Download sequence
Identical sequences Q28NH5
290400.Jann_2820 gi|89055311|ref|YP_510762.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]